PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA07g18740
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family M-type_MADS
Protein Properties Length: 104aa    MW: 11940.1 Da    PI: 10.5172
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA07g18740genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF47.13.2e-15949141
                S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE- CS
      SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifs 41
                ++i+ + nr+ t+ kR++ + KK +EL +LC+++v++ii++
  CA07g18740  9 EFIQGHKNRKSTLVKRKASLVKKISELAILCGIKVCMIIYG 49
                579999**********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.1E-10160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006616.554149IPR002100Transcription factor, MADS-box
CDDcd002664.38E-16249No hitNo description
SuperFamilySSF554552.22E-18298IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-5323IPR002100Transcription factor, MADS-box
PfamPF003191.8E-131149IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-52338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 104 aa     Download sequence    Send to blast
MGRAKINMEF IQGHKNRKST LVKRKASLVK KISELAILCG IKVCMIIYGG ITDQDTSQRV  60
QIWPNDPKEV DELINLYKNQ PLTCRSKRGY DFFQLLRKPK EKS*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016556770.18e-58PREDICTED: agamous-like MADS-box protein AGL17
TrEMBLM1CN252e-32M1CN25_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000710015e-32(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA63421232
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.11e-13M-type_MADS family protein